PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 144aa    MW: 16314.8 Da    PI: 10.64
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016368genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-0961105751
                  HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                   rr   NR+A r++R++Kka ++ Lee vk+L   N++L  el++
  Lus10016368  61 KRRPLGNRVAVRKYRKKKKAHTASLEEQVKKLRVLNQELVTELQR 105
                  456688**********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077165.5E-1256110IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-1156122No hitNo description
SMARTSM003389.1E-857122IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.72657123IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-861105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MVEISRTCIH THTCNPPGPN ATTHSHTCCH THTKVLIIPP GTTLEKQNST TYNRNSKKTT  60
KRRPLGNRVA VRKYRKKKKA HTASLEEQVK KLRVLNQELV TELQRQAVLE SEVVRLRGLL  120
VDFRVKIDHL ELESCPFGNA RSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16078KRRPLGNRVAVRKYRKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008788583.12e-42PREDICTED: uncharacterized protein LOC103706294
SwissprotQ8VY764e-40BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D2RZM34e-40A0A0D2RZM3_G
TrEMBLA0A0D2TKM63e-40A0A0D2TKM6_G
TrEMBLM0SAN56e-40M0SAN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P00670_0012e-39(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.13e-22bZIP family protein